DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and YLR179C

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_013280.1 Gene:YLR179C / 850876 SGDID:S000004169 Length:201 Species:Saccharomyces cerevisiae


Alignment Length:190 Identity:52/190 - (27%)
Similarity:83/190 - (43%) Gaps:41/190 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SDTEVSKIMRSLDVIPDVIHIGPQEFLNVTYHGHLAAHCGKVLEPMQV---RDEPSVKWPS---- 75
            |...|:|:.:. |:|.|.:.....|.|......::.:...|:..||.:   :..|::|:..    
Yeast     2 SSAIVAKLNKE-DIIKDTVKDLAFEILGELSVSYVDSDDIKLGNPMPMEATQAAPTIKFTPFDKS 65

  Fly    76 --APENYYALLMVDPDVPNAITPTHREFLHWMVLNI-----PGNLLAL---GDVRVGYMGATPLK 130
              :.|:..||||.|||.|:.......|..|:::.:|     ||..:|:   |.||..|:|..|.|
Yeast    66 QLSAEDKLALLMTDPDAPSRTEHKWSEVCHYIITDIPVEYGPGGDIAISGKGVVRNNYIGPGPPK 130

  Fly   131 GTGTHRFVFLLYKQRDYTKFDFPKLPKHSVKGRSGFETKRFAK-----KYRFGHPVAGNF 185
            .:|.||:||.|.||           ||       |.::..|.|     .:.:|.|.||.:
Yeast   131 NSGYHRYVFFLCKQ-----------PK-------GADSSTFTKVENIISWGYGTPGAGAY 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 45/164 (27%)
YLR179CNP_013280.1 PEBP_euk 30..190 CDD:176644 44/161 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345737
Domainoid 1 1.000 71 1.000 Domainoid score I2241
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1641
Isobase 1 0.950 - 0 Normalized mean entropy S1728
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - otm46533
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
TreeFam 1 0.960 - -
1110.800

Return to query results.
Submit another query.