DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and TFS1

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_013279.1 Gene:TFS1 / 850875 SGDID:S000004168 Length:219 Species:Saccharomyces cerevisiae


Alignment Length:221 Identity:53/221 - (23%)
Similarity:78/221 - (35%) Gaps:85/221 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VIPDVIH---IGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKW----------PSA------ 76
            ::.||||   ..|...|.|.|........|..|...:.|.:|..::          |.|      
Yeast    20 ILEDVIHDTSFQPSGILAVEYSSSAPVAMGNTLPTEKARSKPQFQFTFNKQMQKSVPQANAYVPQ 84

  Fly    77 PENYYALLMVDPDVPNAITPTHREFLHWM-----------------------VLNIPGNLLALGD 118
            .::.:.|:|.|||.|:.......||.|.:                       ..|..|:     :
Yeast    85 DDDLFTLVMTDPDAPSKTDHKWSEFCHLVECDLKLLNEATHETSGATEFFASEFNTKGS-----N 144

  Fly   119 VRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSVKGRSGFETKRFAK-----KYRFG 178
            ..:.|||..|.||:|.||:|||||||           ||       |.::.:|:|     .:.:|
Yeast   145 TLIEYMGPAPPKGSGPHRYVFLLYKQ-----------PK-------GVDSSKFSKIKDRPNWGYG 191

  Fly   179 HP---------------VAGNFFTSQ 189
            .|               ||.|||.::
Yeast   192 TPATGVGKWAKENNLQLVASNFFYAE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 48/202 (24%)
TFS1NP_013279.1 PEBP_euk 36..216 CDD:176644 48/202 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345738
Domainoid 1 1.000 71 1.000 Domainoid score I2241
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1641
Isobase 1 0.950 - 0 Normalized mean entropy S1728
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - otm46533
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
TreeFam 1 0.960 - -
1110.800

Return to query results.
Submit another query.