DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and FT

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001320342.1 Gene:FT / 842859 AraportID:AT1G65480 Length:219 Species:Arabidopsis thaliana


Alignment Length:211 Identity:67/211 - (31%)
Similarity:94/211 - (44%) Gaps:38/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FAPSLSLKSTRGVHQSDTEV---------SKIMRSLD---------VIPDVIH-IGPQEFLNVTY 48
            |.|.:.:|... ...|.||.         |:...|::         |:.||:. ......|.|||
plant    13 FMPMIQIKEAE-TKTSKTETINTEKPPVCSRSKMSINIRDPLIVSRVVGDVLDPFNRSITLKVTY 76

  Fly    49 HGHLAAHCGKVLEPMQVRDEPSVKWPSAP-ENYYALLMVDPDVPNAITPTHREFLHWMVLNIPGN 112
             |......|..|.|.||:::|.|:..... .|:|.|:|||||||:...|..||:|||:|.:||..
plant    77 -GQREVTNGLDLRPSQVQNKPRVEIGGEDLRNFYTLVMVDPDVPSPSNPHLREYLHWLVTDIPAT 140

  Fly   113 L-LALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSVKG---RSGFETKRFAK 173
            . ...|:..|.|...:|.  .|.||.||:|::|          |.:.:|..   |..|.|:.||:
plant   141 TGTTFGNEIVCYENPSPT--AGIHRVVFILFRQ----------LGRQTVYAPGWRQNFNTREFAE 193

  Fly   174 KYRFGHPVAGNFFTSQ 189
            .|..|.|||..|:..|
plant   194 IYNLGLPVAAVFYNCQ 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 55/148 (37%)
FTNP_001320342.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.