DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and BFT

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_201010.1 Gene:BFT / 836324 AraportID:AT5G62040 Length:177 Species:Arabidopsis thaliana


Alignment Length:166 Identity:54/166 - (32%)
Similarity:80/166 - (48%) Gaps:19/166 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VIPDVIHI-GPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAP-ENYYALLMVDPDVPNA 93
            ||.||:.: .|...:.||::.:.....|..|.|..:..:|.|:..... .:::.|:|:|||.|:.
plant    13 VIGDVLEMFNPSVTMRVTFNSNTIVSNGHELAPSLLLSKPRVEIGGQDLRSFFTLIMMDPDAPSP 77

  Fly    94 ITPTHREFLHWMVLNIPGNL-LALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPK 157
            ..|..||:|||||.:|||.. .:.|...|.|  .||....|.||:||.|:|||.          :
plant    78 SNPYMREYLHWMVTDIPGTTDASFGREIVRY--ETPKPVAGIHRYVFALFKQRG----------R 130

  Fly   158 HSVKG----RSGFETKRFAKKYRFGHPVAGNFFTSQ 189
            .:||.    |..|.|..|:..:....|||..:|.:|
plant   131 QAVKAAPETRECFNTNAFSSYFGLSQPVAAVYFNAQ 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 48/149 (32%)
BFTNP_201010.1 PEBP 1..169 CDD:381878 54/166 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.930

Return to query results.
Submit another query.