DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and ATC

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_180324.1 Gene:ATC / 817302 AraportID:AT2G27550 Length:175 Species:Arabidopsis thaliana


Alignment Length:162 Identity:57/162 - (35%)
Similarity:79/162 - (48%) Gaps:11/162 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VIPDVIHIGPQEF-LNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAP-ENYYALLMVDPDVPNA 93
            ||.||:....|.. :.|||:.....:.|..|.|..|..:|.|:..... .:::.|:|.|||||..
plant    14 VIGDVVDNCLQAVKMTVTYNSDKQVYNGHELFPSVVTYKPKVEVHGGDMRSFFTLVMTDPDVPGP 78

  Fly    94 ITPTHREFLHWMVLNIPGNL-LALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPK 157
            ..|..||.|||:|.:|||.. ::.|...:||  ..|....|.||||:||:||.  .:.....:|.
plant    79 SDPYLREHLHWIVTDIPGTTDVSFGKEIIGY--EMPRPNIGIHRFVYLLFKQT--RRGSVVSVPS 139

  Fly   158 HSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQ 189
            :    |..|.|:.||.:...|.|||..||..|
plant   140 Y----RDQFNTREFAHENDLGLPVAAVFFNCQ 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 51/145 (35%)
ATCNP_180324.1 PEBP 7..175 CDD:412238 57/162 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.930

Return to query results.
Submit another query.