DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and Pbp2

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_083871.3 Gene:Pbp2 / 76400 MGIID:1923650 Length:187 Species:Mus musculus


Alignment Length:165 Identity:66/165 - (40%)
Similarity:93/165 - (56%) Gaps:2/165 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PQEFLNVTYHGHLAAHCGKVLEPMQVRDEP-SVKWPSAPE-NYYALLMVDPDVPNAITPTHREFL 102
            ||..|.|||........|:||.|.||:..| |:.|..... ..|.|::.|||.|:...|.:||:.
Mouse    21 PQHLLRVTYTEAEVEELGQVLTPTQVKHRPGSISWDGLDTGKLYTLILTDPDAPSRKKPVYREWH 85

  Fly   103 HWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSVKGRSGFE 167
            |::|:|:.||.::.|:|...|:|:.|.||||.||:|:|:|:|....:.|.|.|...|...|..|:
Mouse    86 HFLVVNMKGNDISSGNVLSDYVGSGPPKGTGLHRYVWLVYQQDKPLRCDEPILTNRSGDHRGKFK 150

  Fly   168 TKRFAKKYRFGHPVAGNFFTSQWSPDVPSLIKAIS 202
            |..|.|||..|.||||..:.::|...||.|.|.:|
Mouse   151 TAAFRKKYHLGAPVAGTCYQAEWDSYVPKLYKQLS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 58/145 (40%)
Pbp2NP_083871.3 PEBP_euk 23..171 CDD:176644 58/147 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839410
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.