DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and Pebp4

DIOPT Version :10

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_082836.2 Gene:Pebp4 / 73523 MGIID:1920773 Length:242 Species:Mus musculus


Alignment Length:162 Identity:45/162 - (27%)
Similarity:73/162 - (45%) Gaps:19/162 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 CGKVLEPMQVRDEPSVKWPSAPEN-YYALLMVDPDVPNAITPTHREFLHWMVLNIPGNLLALGDV 119
            |....:.:.....|.||:.:|.:. .|.|:|||||.|:...|..:.:.||:|.||.|..:..|.:
Mouse    86 CNLYRQKITAWQAPIVKFHTALDGALYLLVMVDPDAPSRSNPVMKYWRHWLVSNITGADMKSGSI 150

  Fly   120 R----VGYMGATPLKGTGTHRFVFLLYKQ--RDYTKFDFPKLPKHSVKGRS---GFETKRFAKKY 175
            |    ..|...||...||.||:.|.:|.|  ||.:.         ||:.::   |:...:|.::|
Mouse   151 RGNVLSDYSPPTPPPETGLHRYQFFVYLQGDRDISL---------SVEEKADLGGWNLDKFLQQY 206

  Fly   176 RFGHPVAGNFFTSQWSPDVPSLIKAISHNARQ 207
            ....|.....|.:|:..::.|....|:.:..|
Mouse   207 GLRDPDTSTQFMTQFDEELSSEFGRINDDQEQ 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 41/141 (29%)
Pebp4NP_082836.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..50
PEBP_euk 95..219 CDD:176644 40/132 (30%)
Important for secretion. /evidence=ECO:0000250|UniProtKB:Q96S96 210..242 6/29 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.