DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and MRPL38

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_115867.2 Gene:MRPL38 / 64978 HGNCID:14033 Length:380 Species:Homo sapiens


Alignment Length:175 Identity:54/175 - (30%)
Similarity:82/175 - (46%) Gaps:21/175 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DVIH---IGPQEFLNVTY----HGHLAAHCGKVLEPMQVRDEPSVKWPSAPENYYALLMVDPD-- 89
            |:.|   ..|:..|:|.|    ...:..:||..:.|.:....|.|.:.:...:.:.||:...|  
Human   160 DLFHGATFVPRVPLHVAYAVGEDDLMPVYCGNEVTPTEAAQAPEVTYEAEEGSLWTLLLTSLDGH 224

  Fly    90 --VPNAITPTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKF-- 150
              .|:|      |:|||::.|||||.:|.|.|...|:...|.:|:|.||..|||:||.....|  
Human   225 LLEPDA------EYLHWLLTNIPGNRVAEGQVTCPYLPPFPARGSGIHRLAFLLFKQDQPIDFSE 283

  Fly   151 DFPKLPKHSVKGRSGFETKRFAKKYRFGHPVAG-NFFTSQWSPDV 194
            |....|.:.:..|: |.|..|.||::.....|| :||..:|...|
Human   284 DARPSPCYQLAQRT-FRTFDFYKKHQETMTPAGLSFFQCRWDDSV 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 49/154 (32%)
MRPL38NP_115867.2 PEBP_euk 171..321 CDD:176644 49/156 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.