DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and mrpl38

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_012814540.2 Gene:mrpl38 / 549900 XenbaseID:XB-GENE-5959674 Length:406 Species:Xenopus tropicalis


Alignment Length:156 Identity:55/156 - (35%)
Similarity:77/156 - (49%) Gaps:13/156 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPENYYALLMVDPDVPNAITPTHREFLHWMV 106
            |||...|||:|       :.|.:....|.|.:.:...:.:.||:.:||  ..:..|..|::.|:|
 Frog   208 EFLMPVYHGNL-------VTPAEASGPPEVTFEAEEGSLWTLLLTNPD--GHLKETDSEYVLWLV 263

  Fly   107 LNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQ--RDYTKFDFPKLPKHSVKGRSGFETK 169
            .|||||.:..|:....|....|.||||.||.:|||:||  |...|.:....|.||:|.|: |:|.
 Frog   264 GNIPGNQVHSGEQICHYFPPFPAKGTGYHRHIFLLFKQDRRIEFKDELRPNPCHSLKLRT-FKTL 327

  Fly   170 RFAKKYRFGHPVAG-NFFTSQWSPDV 194
            .|.:||......|| .||...|...|
 Frog   328 DFYRKYEESLTPAGLAFFQCAWDDSV 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 51/146 (35%)
mrpl38XP_012814540.2 PEBP_euk 197..347 CDD:176644 53/148 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.