DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and Pebp1

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_651051.1 Gene:Pebp1 / 42644 FlyBaseID:FBgn0038973 Length:176 Species:Drosophila melanogaster


Alignment Length:177 Identity:74/177 - (41%)
Similarity:108/177 - (61%) Gaps:3/177 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MRSLDVIPDVIHIGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPENYYALLMVDPDV 90
            |.:..:|||:|.:.|.....:||...:....||.|.|.||:|:|:|.:.:.|.:.|.:|:||||.
  Fly     1 MDTAGIIPDIIDVKPASKATITYPSGVQVELGKELTPTQVKDQPTVVFDAEPNSLYTILLVDPDA 65

  Fly    91 PNAITPTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPK- 154
            |:...|..||.|||:|:|||||.::.|.....|:||.|.:|||.||:|||::||.|  |....| 
  Fly    66 PSREDPKFRELLHWLVINIPGNKVSEGQTIAEYIGAGPREGTGLHRYVFLVFKQND--KITTEKF 128

  Fly   155 LPKHSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQWSPDVPSLIKAI 201
            :.|.|..||...:.:.:.:||.||.|||||||.:|:...|.:||:.:
  Fly   129 VSKTSRTGRINVKARDYIQKYSFGGPVAGNFFQAQYDDYVKTLIETV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 64/144 (44%)
Pebp1NP_651051.1 PEBP_euk 20..162 CDD:176644 64/143 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466598
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D117065at6960
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
109.900

Return to query results.
Submit another query.