DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and mrpl38

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_005169545.1 Gene:mrpl38 / 405881 ZFINID:ZDB-GENE-040426-2373 Length:386 Species:Danio rerio


Alignment Length:203 Identity:63/203 - (31%)
Similarity:94/203 - (46%) Gaps:19/203 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KSTRGVHQSDTEVSKIMRSLDVIPDVI---HIGPQEFLNVTY--HGHLAAHCGKVLEPMQVRDEP 69
            :.|.|.||    :.::.....:..|:.   :..|:..|.:.|  ....|.|.|..|.|.|....|
Zfish   148 EKTNGPHQ----IRRLAEHYGIYKDLFPMAYFTPRVMLRIGYGDDSSAAVHYGNHLTPSQAEQAP 208

  Fly    70 SVKWPSAPENYYALLMVDPDVPNAITPTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKGTGT 134
            .|.:.:..::.:.||:..||  ..:....:|:|||:|.||||..:|.||....|:...|.:|||.
Zfish   209 HVHYEAEEDSLWTLLLTSPD--EHLLDEEQEYLHWLVGNIPGRAVASGDQICPYLCPFPARGTGL 271

  Fly   135 HRFVFLLYKQRDYTKF--DFPKLPKHSVKGRSGFETKRFAKKYR-FGHPVAGNFFTSQWSPDVPS 196
            |||:|:|:||.....|  |...:|..|:|.|| |:|..|.:|:: ...|....||..||...|..
Zfish   272 HRFIFILFKQDALVDFGSDVRPVPCESLKRRS-FQTLDFYRKHQDLITPAGLAFFQCQWDQSVTQ 335

  Fly   197 LIKAISHN 204
            ..    ||
Zfish   336 TF----HN 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 52/148 (35%)
mrpl38XP_005169545.1 PEBP_euk 179..327 CDD:176644 52/150 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.