DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and CG6180

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster


Alignment Length:207 Identity:84/207 - (40%)
Similarity:115/207 - (55%) Gaps:8/207 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FAPSLSLKSTRGV--------HQSDTEVSKIMRSLDVIPDVIHIGPQEFLNVTYHGHLAAHCGKV 59
            |:.|:..|..:.:        ..|..:|.|.|....|:||||...|.:...|.|.|.:....|:|
  Fly    49 FSNSILTKEPKPIFAFIASQRQYSCEKVGKTMEEHCVVPDVIAKAPAQTAVVEYPGDIVVKPGQV 113

  Fly    60 LEPMQVRDEPSVKWPSAPENYYALLMVDPDVPNAITPTHREFLHWMVLNIPGNLLALGDVRVGYM 124
            |.|.||:|||.|||.:.....|.|.|.|||.|:...|..||:.||:|.||||..:|.|:|...|:
  Fly   114 LTPTQVKDEPCVKWEADANKLYTLCMTDPDAPSRKDPKFREWHHWLVGNIPGGDVAKGEVLSAYV 178

  Fly   125 GATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQ 189
            |:.|...||.||:|||:|:||....||..:||.:|..||.||:...|||||..|:|:|||.:.::
  Fly   179 GSGPPPDTGLHRYVFLIYEQRCKLTFDEKRLPNNSGDGRGGFKIAEFAKKYALGNPIAGNLYQAE 243

  Fly   190 WSPDVPSLIKAI 201
            :...||.|.|.:
  Fly   244 YDDYVPILYKQL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 67/143 (47%)
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 67/141 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452381
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D117065at6960
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
109.900

Return to query results.
Submit another query.