DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and Mrpl38

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001009369.2 Gene:Mrpl38 / 303685 RGDID:1311180 Length:380 Species:Rattus norvegicus


Alignment Length:164 Identity:51/164 - (31%)
Similarity:79/164 - (48%) Gaps:22/164 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPENYYALLMVDPD----VPNAITPTH 98
            :|.::.:.| |||:       .:.|.:....|.|.:.:..::.:.||.::.|    .|:|     
  Rat   179 LGEEDLIPV-YHGN-------EVTPTEASQAPEVTYEADKDSLWTLLFINLDGHLLEPDA----- 230

  Fly    99 REFLHWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKF--DFPKLPKHSVK 161
             |:|||:|.|||.|.:|.|.....|:...|.:|:|.|||.|||:||.....|  |....|.:.:.
  Rat   231 -EYLHWLVTNIPSNRVAEGQESCPYLPPFPARGSGFHRFAFLLFKQDKPINFSEDTRPSPCYQLA 294

  Fly   162 GRSGFETKRFAKKYRFGHPVAG-NFFTSQWSPDV 194
            .|: |.|..|.||::.....|| .||..:|...|
  Rat   295 QRT-FHTLDFYKKHQEAMTPAGLAFFQCRWDDSV 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 48/150 (32%)
Mrpl38NP_001009369.2 PEBP_euk 171..321 CDD:176644 49/156 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.