DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and Pebp1

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_058932.1 Gene:Pebp1 / 29542 RGDID:62017 Length:187 Species:Rattus norvegicus


Alignment Length:160 Identity:65/160 - (40%)
Similarity:87/160 - (54%) Gaps:2/160 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PQEFLNVTYHGHLAAHCGKVLEPMQVRDEP-SVKWPSA-PENYYALLMVDPDVPNAITPTHREFL 102
            ||..|.|.|.|......||||.|.||.:.| |:.|... |...|.|::.|||.|:...|..||:.
  Rat    21 PQHALRVDYGGVTVDELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTDPDAPSRKDPKFREWH 85

  Fly   103 HWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSVKGRSGFE 167
            |::|:|:.||.::.|.|...|:|:.|.|.||.||:|:|:|:|......|.|.|...|...|..|:
  Rat    86 HFLVVNMKGNDISSGTVLSEYVGSGPPKDTGLHRYVWLVYEQEQPLNCDEPILSNKSGDNRGKFK 150

  Fly   168 TKRFAKKYRFGHPVAGNFFTSQWSPDVPSL 197
            .:.|.|||..|.||||..|.::|...||.|
  Rat   151 VESFRKKYHLGAPVAGTCFQAEWDDSVPKL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 59/145 (41%)
Pebp1NP_058932.1 PEBP_euk 25..171 CDD:176644 59/145 (41%)
Interaction with RAF1. /evidence=ECO:0000250 93..134 16/40 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.