DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and F40A3.3

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001300105.1 Gene:F40A3.3 / 179168 WormBaseID:WBGene00018218 Length:226 Species:Caenorhabditis elegans


Alignment Length:200 Identity:75/200 - (37%)
Similarity:113/200 - (56%) Gaps:5/200 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 APSLSLKSTRGVHQSDTEVSKIMRSLDVIPDVIHIG-PQEFLNVTYHGHLAAHCGKVLEPMQVRD 67
            |.:.|.:..||:   .|..::.....:|||||:... |.:.::|.::..:.|:.|.||.|.||:|
 Worm    28 AATTSARFQRGL---ATMAAEAFTKHEVIPDVLASNPPSKVVSVKFNSGVEANLGNVLTPTQVKD 89

  Fly    68 EPSVKWPSAPENYYALLMVDPDVPNAITPTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKGT 132
            .|.|||.:.|...|.|:..|||.|:...||:||:.||:|:|||||.:|.||....|:||.|...|
 Worm    90 TPEVKWDAEPGALYTLIKTDPDAPSRKEPTYREWHHWLVVNIPGNDIAKGDTLSEYIGAGPPPKT 154

  Fly   133 GTHRFVFLLYKQRDYTK-FDFPKLPKHSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQWSPDVPS 196
            |.||:|:|:|||....: .:..:|...|...|.|::...|..|::.|.||.||.|.:::...||.
 Worm   155 GLHRYVYLIYKQSGRIEDAEHGRLTNTSGDKRGGWKAADFVAKHKLGAPVFGNLFQAEYDDYVPI 219

  Fly   197 LIKAI 201
            |.|.:
 Worm   220 LNKQL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 60/144 (42%)
F40A3.3NP_001300105.1 PEBP_euk 64..211 CDD:176644 60/146 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165439
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1728
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.