DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and mrpl-38

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_490808.1 Gene:mrpl-38 / 171682 WormBaseID:WBGene00021327 Length:413 Species:Caenorhabditis elegans


Alignment Length:189 Identity:49/189 - (25%)
Similarity:74/189 - (39%) Gaps:22/189 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DTEVSKIMRSLDVIP----DVIHIGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPE- 78
            |.|...|.|...|..    |.|.....:.|.|.:...:..|.|.|:........|.:...|... 
 Worm   128 DVENLSIYRHFQVFDHLFGDNIFFENVQNLQVNFENDIVVHSGNVITANSTLKRPEITIESVGNG 192

  Fly    79 -NYYALLMVDPDVPNAI-TPTHREFLHWMVLNIP-GNLLALGDVRVGYMGATPLKGTGTHRFVFL 140
             .:..|||::.| .||: ...:.|.:.||:.||| |..::.|...:.|:...|..|||.||..|:
 Worm   193 GGFNTLLMINLD-GNALDLGKNGEIVQWMISNIPDGEAISAGSEIIDYLQPLPFYGTGYHRVAFV 256

  Fly   141 LYKQRDYTKFDFPKLPKHSVKGRS----GFETKRFAKKYRFG-HPVAGNFFTSQWSPDV 194
            |::......|        .::|.|    ..|..:|.||:... .|.|..||.:.:...|
 Worm   257 LFRHEKPVDF--------QIQGNSLDTRIHEISKFYKKHEATITPSAIRFFQTSYDNSV 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 41/152 (27%)
mrpl-38NP_490808.1 PEBP_euk 156..301 CDD:176644 41/153 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.