DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and PEBP4

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001350162.1 Gene:PEBP4 / 157310 HGNCID:28319 Length:227 Species:Homo sapiens


Alignment Length:148 Identity:49/148 - (33%)
Similarity:71/148 - (47%) Gaps:10/148 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 EPSVKWPSAPEN-YYALLMVDPDVPNAITPTHREFLHWMVLNIPGNLLALGDVR----VGYMGAT 127
            ||.||:|.|.:. .|.|:|||||.|:...|..|.:.||:|.:|.|..|..|.::    ..|...:
Human    76 EPIVKFPGAVDGATYILVMVDPDAPSRAEPRQRFWRHWLVTDIKGADLKKGKIQGQELSAYQAPS 140

  Fly   128 PLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQWSP 192
            |...:|.||:.|.:|.|....   ...|||.: |.|..::..||..::..|.|.|...|.:|...
Human   141 PPAHSGFHRYQFFVYLQEGKV---ISLLPKEN-KTRGSWKMDRFLNRFHLGEPEASTQFMTQNYQ 201

  Fly   193 DVPSLIKAISHNARQVAH 210
            |.|:| :|....|.:..|
Human   202 DSPTL-QAPRERASEPKH 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 42/124 (34%)
PEBP4NP_001350162.1 PEBP_euk 46..197 CDD:176644 42/124 (34%)
Important for secretion. /evidence=ECO:0000269|PubMed:27033522 188..227 10/32 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..227 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.