DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and pebp4

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_005170845.2 Gene:pebp4 / 101882266 -ID:- Length:194 Species:Danio rerio


Alignment Length:158 Identity:46/158 - (29%)
Similarity:76/158 - (48%) Gaps:17/158 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPS--------APENYYALLMVDPDVPNAITPTHRE 100
            |.|.|...:...|  ::.|.:.|::.|::|.|        ..|..|.|:|||||.|:...|:...
Zfish    38 LKVIYPDLVVDKC--LIVPQRTREKISMEWGSPEVLLPHAEEEKKYTLVMVDPDAPSRQNPSRSY 100

  Fly   101 FLHWMVLNIPGNLLALGDVR----VGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSVK 161
            :.||::::|.|..|..||||    ..|...||.||||.||:..|:::|.:...   |.|.:...:
Zfish   101 WRHWLLVDIKGEALQTGDVRGTELSAYARPTPPKGTGLHRYQILVFEQPEGRT---PFLNREENR 162

  Fly   162 GRSGFETKRFAKKYRFGHPVAGNFFTSQ 189
            .|..::.:.|.:::......|...|.:|
Zfish   163 SRGNWDLQAFIQRFGLSGAKASLQFLTQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 45/155 (29%)
pebp4XP_005170845.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.