DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and pebp4

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_002932751.1 Gene:pebp4 / 100488878 XenbaseID:XB-GENE-941751 Length:202 Species:Xenopus tropicalis


Alignment Length:177 Identity:53/177 - (29%)
Similarity:79/177 - (44%) Gaps:40/177 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RSLDVI-PDVIHIG----------PQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSA-PEN 79
            :.|||| ||:..:.          |:..:                   :|.|.|.:::..| |..
 Frog    42 KDLDVIYPDIGRVSCIYIPNCFDFPRSLI-------------------KVWDYPLLRYSKAQPGL 87

  Fly    80 YYALLMVDPDVPNAITPTHREFLHWMVLNIPGNLLALGDVRVG-----YMGATPLKGTGTHRFVF 139
            .|.|:|||||.|:...|.:|.:.||::.:|||..|..|....|     |...:|..|||.||:.|
 Frog    88 KYVLIMVDPDAPSRWDPKYRYWRHWVLTDIPGWQLLSGRDLTGNDISAYRRPSPPPGTGYHRYQF 152

  Fly   140 LLYKQRDYTKFDFPKLPKHSVKGRSGFETKRFAKKYRFGHPVAGNFF 186
            .||:|..:....|  ||:..  .||.::.|.|.::.:.|.|||...|
 Frog   153 YLYEQPLWVILYF--LPEEI--RRSTWDLKAFVQRNKLGEPVATTQF 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 46/149 (31%)
pebp4XP_002932751.1 PEBP_euk 42..197 CDD:176644 53/177 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.