DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi20 and Osi19

DIOPT Version :9

Sequence 1:NP_649641.1 Gene:Osi20 / 40777 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_649640.1 Gene:Osi19 / 40776 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster


Alignment Length:300 Identity:62/300 - (20%)
Similarity:110/300 - (36%) Gaps:94/300 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLAFGCALLLVASTSVSGAAIENAVTPRIHSSDELISTIVDKCFHA-NAMHCLKEKVLTYLDT-- 69
            |:..|.|.|:.|..:..|:.         .....||:...:||... ::|.|:||:.:.::|.  
  Fly     6 LVIVGVAALVAAGQAAGGST---------EKMQRLIAEEQNKCASGQDSMACIKERAMRFVDNVM 61

  Fly    70 ------VANVEEEVSG---------RALGDDVIDKVIVDRLGRILNTNEMRLQLP-----QTFFA 114
                  |:|:|...:|         ||...|    ..:|.:...:..:::.:.||     .|..|
  Fly    62 SKDSFQVSNLEVRSNGEKTTPINEARASSAD----GFLDAIENYIRGHDVSMDLPLADAKVTVSA 122

  Fly   115 GSVVTYR-----------SDRGFDLELPKDEGRAEKKNKD----KLFLPLLLLMKFKLKVIMPIL 164
            .::|..:           .|.|.|:|....:|...||.|.    ||.:|:|:|:..|...::|:.
  Fly   123 RNLVNNQLSLNLQLNGDDGDEGTDVEARGKKGNIFKKGKKHRLRKLAMPILVLILLKAITVIPMA 187

  Fly   165 LALIGLKATKALILSKIAIKLVLGFLIYNLIQKLG----------------GMKMNMVPMPAPVP 213
            :.::.:||..||.|...:..:.:|..|:.|.:|:.                |...:.||.|....
  Fly   188 IGILKIKAFNALALGFFSFIVSVGLAIFQLCKKIAHDHHHTAHITAHGPWDGRTFSSVPAPVVEQ 252

  Fly   214 ASEYGVPSTTASSYDPSSWEPMSGGPYARWDSQNLAYSSY 253
            ..:.|                           |.|||.:|
  Fly   253 PQKLG---------------------------QALAYQAY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 17/92 (18%)
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 22/109 (20%)
DUF3671 <152..216 CDD:289205 18/63 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.