DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi20 and Osi18

DIOPT Version :9

Sequence 1:NP_649641.1 Gene:Osi20 / 40777 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_649639.1 Gene:Osi18 / 40775 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster


Alignment Length:319 Identity:67/319 - (21%)
Similarity:128/319 - (40%) Gaps:88/319 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RSTSLLAFGCALLLVASTSVS-GAAIENAVTPRIHSSDELISTIVDKCFHANAMHCLKEKVLTYL 67
            :||:    .|.::.:|:.|.: .|..|..|.|:  |:.:|...:...|....::.|::.|.|.:.
  Fly     2 KSTA----ACLIVALAALSTAHSAPTEGQVAPQ--SATQLALDMYHGCLKDLSVSCVRPKALQWF 60

  Fly    68 D--------------TVANVEEEVSGRALGDDVIDKVIVDRLGRILNTNEMRLQLPQTFFAGSVV 118
            :              ::....|:|..|::..   ::.:.|.:...|.::.:|:|.|:.|......
  Fly    61 NSALRQPEVRITERLSIVRTAEKVESRSMNP---EERLFDDIDSYLGSHSLRIQAPEYFRTSEAR 122

  Fly   119 TYRSDRGFDLELP-----------KDEGRAEKKNKDKLFLPLLLLMKFKLKVIMPILLALIGLKA 172
            :...|  |.:..|           .:|||...:   |..||.||.:|.|..|::|:.|.||.||.
  Fly   123 SLVPD--FLMSNPLTQGGLVPLAAANEGRGMIR---KAVLPFLLGLKLKTTVLVPLALGLIALKT 182

  Fly   173 TKALILSKIAIKLVLGFLIYNLIQ-KLGGMKM--------NMVP--MPAPVPAS-EYGVP----- 220
            .||:.|..:::.|....:|:.:.: |:...::        ::||  :...||.. |:.||     
  Fly   183 WKAMTLGLLSLVLSGALVIFKIAKPKIVNYEVVHYPHHVDHVVPHHIEHVVPHHIEHVVPHHIEH 247

  Fly   221 ----------------------------STTASSYDPSSWEPMSGGPYARWDSQNLAYS 251
                                        ...:.::||.:|...|..|.   |:|:|||:
  Fly   248 IVPHHIDHHLEHHIDHHVDLPVEHIEHLEHPSPAWDPHAWARSSQEPQ---DAQDLAYA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 15/78 (19%)
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 16/105 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2B2N3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.