DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi20 and Osi13

DIOPT Version :9

Sequence 1:NP_649641.1 Gene:Osi20 / 40777 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_649634.1 Gene:Osi13 / 40769 FlyBaseID:FBgn0037422 Length:210 Species:Drosophila melanogaster


Alignment Length:114 Identity:32/114 - (28%)
Similarity:55/114 - (48%) Gaps:12/114 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 LELPKDEGRAEKKNKDKLF---LPLLLLMKFKLKVIMPILLALIGLKATKALILSKIAIKLVLGF 189
            ||....|||.:.|.:.||.   .|||..:.....|::|::|..:...:|.:.::.|||: :..|.
  Fly    84 LETWSTEGRGKHKKQKKLMKMVYPLLAAVAVAKVVLLPLILKWLTALSTSSFVMGKIAL-VTSGI 147

  Fly   190 LIYNLIQKLGGM---KMNMVPMPAPVPASEYGVPSTTASSYDPSSWEPM 235
            |....|.. ||.   ::.::...||:..   |:.::..|| ..|||.|:
  Fly   148 LALKWILS-GGHAHDRLEIIHSHAPLVK---GLHASDLSS-SGSSWMPI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 5/12 (42%)
Osi13NP_649634.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.