DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi20 and Osi6

DIOPT Version :9

Sequence 1:NP_649641.1 Gene:Osi20 / 40777 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001287192.1 Gene:Osi6 / 40760 FlyBaseID:FBgn0027527 Length:312 Species:Drosophila melanogaster


Alignment Length:308 Identity:68/308 - (22%)
Similarity:115/308 - (37%) Gaps:79/308 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 STSL---LAFGCALLLVASTSVSGAAIENAVTPRIHSSDELISTIVDKCFHANAMHCLKEKVLTY 66
            :||:   :|..|.|||.|..|..          .:.:::|...... :|..::::.||:   ||.
  Fly    24 ATSMKFFVATACILLLAAGISAD----------PVKAAEEQPGAFA-QCLESDSISCLQ---LTL 74

  Fly    67 LDTVANVEEEVSGRALGDDVIDKVIVDRLGRILN---------TNEMRLQLPQTFFAGSVVTYRS 122
            .....:|.:.......|...:.|....|.|:.|:         |.|.|......:|..:..::.:
  Fly    75 FRKAKSVFDNPQIELFGGVSLVKSNEGRQGKSLDNSLAVEAAPTVEARTAEMGNYFMDNAKSFFA 139

  Fly   123 DRGFDLE-----------LPKD----------EGRAEKKNKDKLFLPLLLLMKFKLKVI-MPILL 165
            :|..:..           :|.|          |.|..||...|.|||:||.:..|:.|: :..:.
  Fly   140 ERSLNFNFANAARSVARAIPDDIKADLRELVVESRTRKKKLLKKFLPILLGVGAKIAVLGVGSIF 204

  Fly   166 ALIGLKATKALILSKIAIKLVLGFLIYNLIQKLGGMKMNMVPMPAPVPASEYGVPSTTASSYDPS 230
            .|:.| |.|||::|.||..|.|.....:.:.::||                            ..
  Fly   205 GLLFL-AKKALVVSVIAFFLALAAGASSGLGRIGG----------------------------SG 240

  Fly   231 SWEPMSGGPYARWDSQNLAYSSYHPSSSSSYSSGSSSGSSGSSSSYSS 278
            ....:.||....:..:|...||  .:|:..:|||..:.|:|.||..||
  Fly   241 GGGGLLGGLGGLFGGKNAGGSS--AASTGGWSSGGGASSAGWSSGGSS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 16/97 (16%)
Osi6NP_001287192.1 DUF1676 81..176 CDD:285181 15/94 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.