DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi20 and Osi5

DIOPT Version :9

Sequence 1:NP_649641.1 Gene:Osi20 / 40777 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_649624.1 Gene:Osi5 / 40759 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster


Alignment Length:272 Identity:60/272 - (22%)
Similarity:100/272 - (36%) Gaps:101/272 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FRSTSLLAFGCALLLVASTSV-----SGA--------AIENAVTPRIHSSDELISTIVDKCFHAN 54
            ||:..||   |.|.|.|..|.     :||        |:.|.:.....|...|:           
  Fly     2 FRTFPLL---CLLFLTAVRSENCDQDAGATLYCRGERALRNVLRNLNRSDKPLV----------- 52

  Fly    55 AMHCLKEKVLTYLDTVANVEEEVSGRALGDDVIDKV--IVDRLGRILNTNEMRLQLPQTFFAGSV 117
                    |:..|:.|     .:...::.|:..|:.  ::|.|...|.|:|:.::|         
  Fly    53 --------VIRGLEIV-----PLQNNSISDEEPDQEQGLLDSLSFYLRTHEINVKL--------- 95

  Fly   118 VTYRSDRGFDLELPKDEGR---AEKKNKDKLFLPLLLLMKFKLKVIMPILLALIGLKATKALILS 179
                      .:|.:||.:   |.||:|.:..|..:.||..|:..:|.  |..|...|.|||.:|
  Fly    96 ----------ADLLEDESQVSEARKKDKGQGMLLAMALMFGKMMAVMG--LGGIAALAMKALGVS 148

  Fly   180 KIAIKLVLGFLIYNLIQKLGGMKMNMVPMPAPVPASEYGVPSTTASSY------------DPSSW 232
            .:|: ::.|.|         |:|          .|:::|..|:.:.||            ..|..
  Fly   149 LVAL-MMAGML---------GLK----------TAAQHGGESSHSISYVTGEGHHHKRRRRSSGQ 193

  Fly   233 EPMSGGPYARWD 244
            :|::   |..||
  Fly   194 QPLA---YRGWD 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 13/72 (18%)
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 18/89 (20%)
RCR 184..>201 CDD:304939 3/19 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.