DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi20 and Osi16

DIOPT Version :9

Sequence 1:NP_649641.1 Gene:Osi20 / 40777 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_731065.1 Gene:Osi16 / 318801 FlyBaseID:FBgn0051561 Length:278 Species:Drosophila melanogaster


Alignment Length:293 Identity:70/293 - (23%)
Similarity:111/293 - (37%) Gaps:67/293 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLAFGCALLLVAS---TSVSGAAIENAVTPRIHSSDELISTIVDKCFHANAMHCLKEKVLTYLD 68
            :|.||.|.....||   |.|...|.|....|:  .::.|:|......|   :..|||.:.:..::
  Fly    14 ALFAFMCKYATAASVQPTEVPAVAPETIRIPQ--RAESLLSGCEASSF---SWMCLKIEFVKIME 73

  Fly    69 TVANVEEEVSGRALGDDVID--KVIVDRLGRILNTNEMRLQL-------PQTFFAGSVVTYRSD- 123
            .:|..||.        :|:.  .|:.|.....|.|:|:..::       |.|...|.:|....: 
  Fly    74 KLAEQEEL--------NVLPGISVVKDENATELKTSELMAEVARSYPSDPSTRLNGYIVAKLENL 130

  Fly   124 ---RGFDLELPKD----EGRAEKKNKDKLFLPLLLLMKFKLK-VIMPILLALIGLKATKALILSK 180
               |.....|..|    |||..|..| |..|..|:.....:| ::|.:.|..|.|.|.|||:.:.
  Fly   131 LRTRFLRFRLLDDKSLVEGRKHKFGK-KGGLEALVAAGVMMKGMLMAMGLGAIALMAGKALMTAL 194

  Fly   181 IAIKL--VLGFLIYNLIQKLGGMKMNMVPMPAPVPASEYGVPSTTASSYDPSSWEPMSGGPYARW 243
            :|:.|  |||      ::.|.|                .|..|||        :|.::...|...
  Fly   195 MALTLSGVLG------LKSLAG----------------GGGKSTT--------YEIVAKPIYTSS 229

  Fly   244 DSQNLAYSSYHPSSSSSYSSGSSSGSSGSSSSY 276
            .|.::.:.....|.|..:::|...|.:.|...|
  Fly   230 HSHSVTHEDGGHSHSPHFAAGGGGGGTASGFGY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 19/84 (23%)
Osi16NP_731065.1 DUF1676 72..156 CDD:285181 20/91 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.