DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi19 and Osi15

DIOPT Version :9

Sequence 1:NP_649640.1 Gene:Osi19 / 40776 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_649636.1 Gene:Osi15 / 40771 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster


Alignment Length:278 Identity:67/278 - (24%)
Similarity:111/278 - (39%) Gaps:86/278 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AKLLLVIVGVAALVAAGQAAGGSTEKMQRLIAEEQNKCASGQDSMACIKERAMRFVDNVMSKDSF 66
            ||.:.|:: :|:|| .|..|..|.:..:|.:....|:..| ::|:|..  ..:| :|...|..||
  Fly     3 AKFVCVVL-LASLV-CGSMALPSQDNTERDLVNMLNRLDS-EESVALF--GGLR-IDRSESGRSF 61

  Fly    67 QVSNLEVRSNGEKTTPINEARASSADGFLDAIENYIRGHDVSMDLPLADAKVTVSARNLVNNQLS 131
            ..|                   .:.:.|.|..|.|:..|:                         
  Fly    62 GAS-------------------KAVESFEDRAERYLETHE------------------------- 82

  Fly   132 LNLQLNGDDGDEGTDVEARGKKGNIFKKGKKHRLRKLAMPILVLILLKAITVIPMAIGILKIKAF 196
            |||..:||:.||.::.|..|:   ...:.:..|::|:.:|:|:.:.||...|:.:...|:|..:.
  Fly    83 LNLSFSGDEQDENSENEYTGR---AMDESRSKRMKKMLLPLLLALKLKKAVVVKIMFTIIKFISL 144

  Fly   197 NALALGFFSFIVSVGLAIFQ--LCKKIAHDHHHTAHIT--------AHGPWDGRTFSSVPAPVVE 251
            .|||:.|.:.|:: |...|:  |.||  .:|..||:||        .|..|              
  Fly   145 KALAISFLALILA-GATFFKDLLAKK--KEHITTAYITGSPLNADIVHSDW-------------- 192

  Fly   252 QPQKLGQA----LAYQAY 265
              .:.|||    |||..|
  Fly   193 --SRNGQAGAADLAYNHY 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 19/105 (18%)
DUF3671 <152..216 CDD:289205 15/63 (24%)
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 39/183 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.