DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi19 and Osi13

DIOPT Version :9

Sequence 1:NP_649640.1 Gene:Osi19 / 40776 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_649634.1 Gene:Osi13 / 40769 FlyBaseID:FBgn0037422 Length:210 Species:Drosophila melanogaster


Alignment Length:111 Identity:27/111 - (24%)
Similarity:45/111 - (40%) Gaps:19/111 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 VNNQLSLNLQLNGDDGDEGTDVEARGKKGNIFKKGKKHRLRKLAMPILVLILLKAITVIPMAIGI 190
            |||.|            |....|.|||    .||.||  |.|:..|:|..:.:..:.::|:.:..
  Fly    80 VNNML------------ETWSTEGRGK----HKKQKK--LMKMVYPLLAAVAVAKVVLLPLILKW 126

  Fly   191 LKIKAFNALALGFFSFIVSVGLAIFQLCKKIAHDHHHTAHITAHGP 236
            |...:.::..:|..:.:.| |:...:......|.|.....|.:|.|
  Fly   127 LTALSTSSFVMGKIALVTS-GILALKWILSGGHAHDRLEIIHSHAP 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 12/36 (33%)
DUF3671 <152..216 CDD:289205 14/63 (22%)
Osi13NP_649634.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.