DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi19 and Osi11

DIOPT Version :9

Sequence 1:NP_649640.1 Gene:Osi19 / 40776 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_649630.1 Gene:Osi11 / 40765 FlyBaseID:FBgn0037418 Length:302 Species:Drosophila melanogaster


Alignment Length:312 Identity:72/312 - (23%)
Similarity:117/312 - (37%) Gaps:91/312 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VAALVAAGQAAG---------GSTEK-MQRLIAEEQNKCASGQDSMACIKERAMR---------- 55
            :|.|:||.||..         .|||. :.|.:.....:||..:|...|.|.:.:|          
  Fly     9 IALLLAAFQAWAMEAPSNYNQNSTESGLLRTVRHIYGQCAYSEDVFWCCKIQGVRLLGRALKVPQ 73

  Fly    56 --FVDNV--MSKDSFQVSNLEVRSNGEKTTPINEARASSAD------GFLDAI-----ENYIRGH 105
              .||.|  :.::||.......||:      :.|::.|:.|      ..|||:     .|::..|
  Fly    74 LGIVDGVSLVRRESFTQDTRSGRSS------LLESQLSNRDLEHLSGKSLDALLLERFLNFVHSH 132

  Fly   106 DVSMDLPLADAKVTVSARNLVNNQLSLNLQLNGDDGDEGTDVEARGKKGNIFKKGKKHRLRKLAM 170
            .:.::||   ..:....||:.:..|.:          .|..:.|...:|.     ||...:|...
  Fly   133 QLQVNLP---RLLRFGERNVQDWLLHV----------VGYFMPASESEGR-----KKKDDKKYLG 179

  Fly   171 PILVLILLKAITVIPMAIGILKIKAFNALALGFFSFIVSVGLAIFQLCKKIAHD----------- 224
            |.:..:|||. .::.||...:.|.|..||.:|..:.|:|   ||..|.|.:.||           
  Fly   180 PFIAAVLLKT-AILKMAYHSIAIVAGKALIVGKIALIIS---AIIGLKKLVGHDGGEKTTYEIVK 240

  Fly   225 -----HHHTAHITAHGPWD------GRTFSSVPAPVVEQPQKLGQALAYQAY 265
                 ..||...:..|.:|      |....|:...::.|.:      ||||:
  Fly   241 HPQVQQSHTYSSSHQGEYDTGGHDGGSYHRSIDDEMMMQDK------AYQAW 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 24/118 (20%)
DUF3671 <152..216 CDD:289205 19/63 (30%)
Osi11NP_649630.1 DUF1676 65..180 CDD:285181 26/138 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.