DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi19 and Osi9

DIOPT Version :9

Sequence 1:NP_649640.1 Gene:Osi19 / 40776 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_649628.2 Gene:Osi9 / 40763 FlyBaseID:FBgn0037416 Length:233 Species:Drosophila melanogaster


Alignment Length:275 Identity:72/275 - (26%)
Similarity:112/275 - (40%) Gaps:74/275 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ALVAAGQAAGGSTEKMQRLIAEEQNKCASGQDSMA-CIKERAMRFVD------------NVMSKD 64
            ||:|:..||....:.:.....:....|  |:.||. |:||||:.:.|            .::..|
  Fly     9 ALIASTAAATSEADSLLTSALKMVKDC--GERSMVLCMKERALHYFDAENGDVRLTEGIALVKTD 71

  Fly    65 SFQVSNLEVRSNGEKTTPIN-EARASSADGFL-DAIENYIRGHDVSMDLPLADAKVTVSARNLVN 127
            ...|.    ||..|...|.. |||.:..|..| :.:..:...|.:...:|         ..::.:
  Fly    72 EIPVG----RSLNEMQLPEEVEAREAEVDSLLVERVARFFGTHTLQFKVP---------KDSIQD 123

  Fly   128 NQLSLNLQLNGDDGDEGTDVEARGKKGNIFKKGKKHRLRKLAMPILVLILLKAITVIPMAIGILK 192
            .|.:|.              |:|||     ||.||    |..||:|:|..||...::|:|||.|.
  Fly   124 MQRALE--------------ESRGK-----KKEKK----KYLMPLLMLFKLKMAALLPLAIGFLA 165

  Fly   193 IKAFNALALGFFSFIVS--VGLAIFQLCKK-----IAHDHHHTAHITAHGPWDGRTFSSVPAPVV 250
            :.:|.||.:|..:.::|  :||......||     :||.|:...|  ::|       .|:|:   
  Fly   166 LISFKALVIGKIALLLSGIIGLKKLLESKKENYEVVAHPHYEHEH--SYG-------RSLPS--- 218

  Fly   251 EQPQKLGQALAYQAY 265
              .....|.|||.||
  Fly   219 --DDSQAQQLAYAAY 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 23/119 (19%)
DUF3671 <152..216 CDD:289205 24/65 (37%)
Osi9NP_649628.2 DUF1676 54..144 CDD:285181 24/125 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.