DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi19 and Osi8

DIOPT Version :9

Sequence 1:NP_649640.1 Gene:Osi19 / 40776 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_649627.1 Gene:Osi8 / 40762 FlyBaseID:FBgn0037415 Length:274 Species:Drosophila melanogaster


Alignment Length:231 Identity:55/231 - (23%)
Similarity:89/231 - (38%) Gaps:71/231 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GSTE--KMQRLIAEEQNKCASGQDSMACIK-------ERAMRFVDNVMSKDSFQVSNLEVRSNGE 78
            |||.  |...::.....:| ||.:...|:|       |:|.|...::...:..|.    |.|.||
  Fly    50 GSTGLWKDMSMVYRIYQQC-SGDNMSVCLKVKLLTGLEKAFRSAKSLSLMEGIQF----VSSGGE 109

  Fly    79 ----KTTPINEARASSADGFLDAIENYIRGHDVSMDLPLADAKVTVSARNLVNNQLSL------- 132
                |..||:|                   .|:...||.     :|.|:..|.|.:.|       
  Fly   110 SEETKRAPISE-------------------KDIEAVLPR-----SVDAKEQVLNNMILKRVGNFL 150

  Fly   133 ---NLQLNGDDGDEGTDVEARGKKGNIFKKGKKHRLRKLAMPILVLILLKAITVIPMAIGILKIK 194
               .||:..|  :|...||.|.||.   |||..        .::::.||...|::|:|.|.|.:.
  Fly   151 QDHTLQVKFD--NEANSVEGRKKKE---KKGNG--------AMIMIPLLLGGTIVPLAYGALAML 202

  Fly   195 AFNALALGFFSFIVSVGLAIFQLC------KKIAHD 224
            |..||.:...:.:::..:.|.:|.      |:.:|:
  Fly   203 AGKALIVSKLALVLASIIGIKKLLSGGGGGKESSHE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 29/119 (24%)
DUF3671 <152..216 CDD:289205 16/63 (25%)
Osi8NP_649627.1 DUF1676 85..>169 CDD:285181 26/113 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.