DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi19 and Osi3

DIOPT Version :9

Sequence 1:NP_649640.1 Gene:Osi19 / 40776 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001262304.1 Gene:Osi3 / 40757 FlyBaseID:FBgn0037411 Length:288 Species:Drosophila melanogaster


Alignment Length:271 Identity:59/271 - (21%)
Similarity:106/271 - (39%) Gaps:74/271 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LIAEEQNKCASGQDSMACIKERAMRFVDN-------VMSKDSFQVS---NLE-VRSNGEKTTPIN 84
            |:|:.:..|.. :|..|| |...|..|.|       :...|.|:|:   |:. |..:.|....::
  Fly    43 LLAKLKQNCRQ-EDDRAC-KMVKMSIVMNHLYLNTRIDLGDRFKVTENGNISMVPDDPEVNQLLS 105

  Fly    85 EARASSADGFLDAIEN----YIRGHDVSMDLPLADAKVTVSARNLVNN--QLSLNLQLNGDDGDE 143
            .:..|..:.|...:.|    :||...:..       |.:.:...::|:  :.||||         
  Fly   106 RSMGSDEETFALLMANKLWKFIRSRSLRY-------KFSENTDFVINSDPEGSLNL--------- 154

  Fly   144 GTDV-------EARGKKGNIFKKGKKHRLRKLAMPILVLILLKAITVIPMAIGILKIKAFNALAL 201
            |..|       |.|||..|:             .|:|:::..|...|..:.:..|.:.|..||.:
  Fly   155 GVSVRPLEALQEGRGKMKNM-------------GPLLMMMAAKTGMVGALLLKGLFLLAGKALIV 206

  Fly   202 GFFSFIVSVGLAIFQL--CKK--IAHDHHHTAHITAHGPWDGRTFS-------SVPAPV----VE 251
            ...:.:::|.:::.:|  .||  :....||.::.:.   | .|.|.       .|||.:    |:
  Fly   207 SKIALLLAVIISLKKLLSSKKTIVEVPSHHDSYSSG---W-SRAFDGFVEGLVDVPADILAKEVQ 267

  Fly   252 QPQKLGQALAY 262
            ..|:..|.:||
  Fly   268 HQQEQAQNMAY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 26/129 (20%)
DUF3671 <152..216 CDD:289205 11/63 (17%)
Osi3NP_001262304.1 DUF1676 68..180 CDD:285181 27/140 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.