DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi19 and Osi2

DIOPT Version :9

Sequence 1:NP_649640.1 Gene:Osi19 / 40776 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001262303.1 Gene:Osi2 / 40756 FlyBaseID:FBgn0037410 Length:390 Species:Drosophila melanogaster


Alignment Length:312 Identity:64/312 - (20%)
Similarity:111/312 - (35%) Gaps:101/312 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IAEEQNKCASGQDSMACIKERAMRFVDNVMSKDSFQVSNL---------EVRSNGEKTTPINEAR 87
            :|...:.|..| |...|.|.:|:...|.:..||.:::|:.         :.||..::....:|..
  Fly    84 LARTNSNCLGG-DLSECFKTQALNTFDEIFFKDQYKLSDFARVVRLPETQQRSLLQEPFEYSEEP 147

  Fly    88 ASSADGF-------LDAIENYIRGHDVSMDLPLADAKVTVSAR---NLVNNQLSLNLQLNGDDGD 142
            ....|.:       |...|.:|:...:.::.|   .::|.:.|   ..:.|.:...|.|. |||.
  Fly   148 RGDDDEWNQLLKYGLRRAERFIKSTALEVEWP---EELTEAGRYEARFIGNDIDGELDLI-DDGQ 208

  Fly   143 EGTDVEARGKKGNIFKKGKKHRLRKLAMPILVLI---LLKAITVIPMAIGILKIKAFNALALGFF 204
                     :.|:..:|    :|:|:.:|:|:::   .||.:..:|..:||..:|....||.   
  Fly   209 ---------RAGHFSRK----KLKKMIIPLLLVLKIFKLKLLLFLPFILGIAGLKKILGLAA--- 257

  Fly   205 SFIVSVGL-AIFQLCK--------------------------------KIAHDHHHTAHITAHGP 236
              ||..|| |.|:||:                                ...:.|||......||.
  Fly   258 --IVLPGLFAYFKLCRPPGGVGGAFGGGLSGLFGGKNTFPEYNPQGVGAATYYHHHEHFEGGHGG 320

  Fly   237 WDGRTFSSVPA---PVVE-----------QPQKLG---------QALAYQAY 265
            ..|..:...|:   |..:           |.|::|         |..||..|
  Fly   321 APGPYYRQEPSFAKPYTDYYSKSYQGQQVQGQQVGGNSVSFGDPQEAAYNGY 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 22/124 (18%)
DUF3671 <152..216 CDD:289205 19/67 (28%)
Osi2NP_001262303.1 DUF1676 108..224 CDD:285181 24/132 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.