DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi19 and Osi16

DIOPT Version :9

Sequence 1:NP_649640.1 Gene:Osi19 / 40776 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_731065.1 Gene:Osi16 / 318801 FlyBaseID:FBgn0051561 Length:278 Species:Drosophila melanogaster


Alignment Length:223 Identity:44/223 - (19%)
Similarity:81/223 - (36%) Gaps:43/223 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CASGQDSMACIKERAMRFVDNVMSKDSFQV-SNLEVRSNGEKTTPI--NEARASSADGFLDAIEN 100
            |.:...|..|:|...::.::.:..::...| ..:.|..: |..|.:  :|..|..|..:......
  Fly    54 CEASSFSWMCLKIEFVKIMEKLAEQEELNVLPGISVVKD-ENATELKTSELMAEVARSYPSDPST 117

  Fly   101 YIRGHDVSMDLPLADAKVTVSARNLVNNQLSLNLQLNGDDGDEGTDVEAR----GKKG------- 154
            .:.|:            :.....||:..:. |..:|.    |:.:.||.|    ||||       
  Fly   118 RLNGY------------IVAKLENLLRTRF-LRFRLL----DDKSLVEGRKHKFGKKGGLEALVA 165

  Fly   155 -NIFKKGKKHRLRKLAMPILVLILLKAITVIPMAIGILKIKAFNALALGFFSF----IVSVGLAI 214
             .:..||   .|..:.:..:.|:..||:....||:.:..:....:||.|....    ||:..:..
  Fly   166 AGVMMKG---MLMAMGLGAIALMAGKALMTALMALTLSGVLGLKSLAGGGGKSTTYEIVAKPIYT 227

  Fly   215 FQLCKKIAHD---HHHTAHITAHGPWDG 239
            ......:.|:   |.|:.|..|.|...|
  Fly   228 SSHSHSVTHEDGGHSHSPHFAAGGGGGG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 22/120 (18%)
DUF3671 <152..216 CDD:289205 16/75 (21%)
Osi16NP_731065.1 DUF1676 72..156 CDD:285181 16/101 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.