DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi18 and Osi23

DIOPT Version :9

Sequence 1:NP_649639.1 Gene:Osi18 / 40775 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_651794.2 Gene:Osi23 / 43615 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster


Alignment Length:212 Identity:42/212 - (19%)
Similarity:91/212 - (42%) Gaps:33/212 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DMYHGCLKDLSVSCVRPKALQWFNSALRQPEVRITERLSIVRTAEKVESRSMNPEER-------L 95
            |.|...:.....||.|.::|..|...:..||:.|.:.:.:|......::.:...:||       .
  Fly    44 DCYQSGIHQSLWSCFRSRSLHIFEGIMSSPEISIYDGVRLVAAPNSTDNATRPDDERKDLKHLTW 108

  Fly    96 FDDIDSYLG----SHSLRI---QAPEYFRTSEARSLVPDFLMSNPLTQGGLVPLAAANEGRGMIR 153
            ||.:...|.    :|:|::   :..|.:.:|:.         |||      .|:.:|...|... 
  Fly   109 FDQLAVSLAKGLTTHTLQVNLGKLTERYLSSDT---------SNP------DPVGSARVRRHRY- 157

  Fly   154 KAVLPFLLGLKLKTTVLVPLALGLIALKTWKAMTLGLLSLVLSGALVIFKIAKPKIVNYEVVHYP 218
            ..::..:.|:.....:|||:...::::.:.||:.|..::|:|:....:.::|...: :|.:.|.|
  Fly   158 NMIITMMFGVTALGAILVPMGFQMLSIVSGKALLLAKMALLLASINGLKRVANNGL-HYGLYHVP 221

  Fly   219 HHVDHVVPHHIEHVVPH 235
            .  :|:..::....|.|
  Fly   222 G--EHLGGYYDRGDVSH 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 20/111 (18%)
Osi23NP_651794.2 DUF1676 66..163 CDD:285181 20/112 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.