DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi18 and Osi15

DIOPT Version :9

Sequence 1:NP_649639.1 Gene:Osi18 / 40775 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_649636.1 Gene:Osi15 / 40771 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster


Alignment Length:140 Identity:41/140 - (29%)
Similarity:61/140 - (43%) Gaps:34/140 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 ERLFDDIDSYLGSHSLRI--QAPEYFRTSEARSLVPDFLMSNPLTQGGLVPLAAANEGRG-MIRK 154
            |...|..:.||.:|.|.:  ...|....||           |..|.      .|.:|.|. .::|
  Fly    68 ESFEDRAERYLETHELNLSFSGDEQDENSE-----------NEYTG------RAMDESRSKRMKK 115

  Fly   155 AVLPFLLGLKLKTTVLVPLALGLIALKTWKAMTLGLLSLVLSGALVIFK--IAKPK--------- 208
            .:||.||.||||..|:|.:...:|...:.||:.:..|:|:|:|| ..||  :||.|         
  Fly   116 MLLPLLLALKLKKAVVVKIMFTIIKFISLKALAISFLALILAGA-TFFKDLLAKKKEHITTAYIT 179

  Fly   209 --IVNYEVVH 216
              .:|.::||
  Fly   180 GSPLNADIVH 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 15/67 (22%)
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 33/112 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.