DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi18 and Osi14

DIOPT Version :9

Sequence 1:NP_649639.1 Gene:Osi18 / 40775 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_649635.1 Gene:Osi14 / 40770 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster


Alignment Length:343 Identity:72/343 - (20%)
Similarity:113/343 - (32%) Gaps:125/343 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ACLIVALAALSTAHSAPT--EGQVAPQSATQLALDMYHGCLK-DLSVSCVRPKALQWFNSALRQP 67
            ||  |.|.|.|...:||:  :.||...:....|......||: |...:|:..|.:...|.|.|..
  Fly     7 AC--VTLLAASCVFAAPSVQDNQVEGDNTLGRAARYLGACLESDDMATCLAVKGITALNRAARSN 69

  Fly    68 EVRITERLSIVRTAEKVESRS--------------MNPEERLFDDID-------SYLGSHSLRIQ 111
            .:.:...::..|......||:              .|.:||....:|       .:|.:|:|..:
  Fly    70 NIELASGVTFQRDPASPVSRTGKSMSEQDVYAELPQNADERTGRLVDLAVSSAADFLSTHNLEFK 134

  Fly   112 APEYFRTSEARSLVPDFLMSNPLTQGGLVPLAAANEGRGMIRKAVLPFLLGLKLKTTVLVPLALG 176
            .|.......||:|                     :||||.|:|.:.|..|.:..|...::||.||
  Fly   135 LPAETTQQVARAL---------------------DEGRGKIKKMLGPVALAIGAKLFAVIPLVLG 178

  Fly   177 LIALKTWKAMTLG----LLSLVLSGALVIFKIAKPKIVNYEVVHYPHHVDHVVPHHIEHVVPHHI 237
            .:||.|:||:.:.    .|::::.|:.::.........|.....|                    
  Fly   179 FLALLTFKAVIVAKLAFFLAILVGGSRLLGGFGNKFGGNSFAGAY-------------------- 223

  Fly   238 EHVVPHHIEHIVPHHIDHHLEHHIDHHVDLPVEHIEHLEHPSPAWDPHA-------------WAR 289
                                                    .|.||...|             :||
  Fly   224 ----------------------------------------NSNAWSAPASAGWSSGASSSYPYAR 248

  Fly   290 S-SQEPQDAQDLAYAGQK 306
            | |::..|||.||||||:
  Fly   249 SISEDGSDAQQLAYAGQQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 23/118 (19%)
Osi14NP_649635.1 DUF1676 62..160 CDD:285181 23/118 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.