DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi18 and Osi7

DIOPT Version :9

Sequence 1:NP_649639.1 Gene:Osi18 / 40775 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_649626.1 Gene:Osi7 / 40761 FlyBaseID:FBgn0037414 Length:288 Species:Drosophila melanogaster


Alignment Length:321 Identity:86/321 - (26%)
Similarity:133/321 - (41%) Gaps:69/321 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CLIVALAALSTAHSAPTEGQVAPQSATQLALDMYHGCLKDLSVSCVRPKALQWFNSAL-RQPEVR 70
            || |||:|...|.......:.|......:...:|..||:..|||||:.|...:.:..| .:.:..
  Fly    12 CL-VALSAALPAEETRGHARNAIGGENDIMDSIYSDCLRKDSVSCVKYKLFSFVDKVLGARDQFA 75

  Fly    71 ITERLSIVRTAEKVE---SRSMNPEERL----FDDIDSYLGSHSLRIQ---APEYFRTSEARSLV 125
            :||.:::||:.:..:   :||::.:|..    .:.|.|:|.||:::::   |......|.....:
  Fly    76 LTEGVTVVRSPDAPQQEAARSISGDESFESLALNRISSFLNSHTIKVELKGADIVQAVSSTGRAL 140

  Fly   126 PD-----FLMSNPLTQGGLVPLAAANEGRGMIRKAVL---PFLLGLKLKTTVLVPLALGLIALKT 182
            .|     |..::|         .|..|.||..:||..   |.|..:.||...|:||.||.|||..
  Fly   141 EDASESLFGSNDP---------NAPEESRGKKKKAAKILGPILALVALKAAALLPLLLGAIALIA 196

  Fly   183 WKAMTLGLLSLVLSGALVIFK-IAKPKIVNYEVVHYPHHVDHVVPHHIEHVVPHHIEHVVPHHIE 246
            .||:.:|.::||||..:.:.| :::.|.|.||||.:|||..                        
  Fly   197 GKALLIGKIALVLSAVIGLKKLLSQEKHVTYEVVAHPHHSS------------------------ 237

  Fly   247 HIVPHHIDHHLEHHIDHHVDLPVEHIEHLEHPSPAWDPH-AWARSSQEPQDAQDLAYAGQK 306
                .|...|..:...:..|.......:      ....| .|.||.    |||||||..||
  Fly   238 ----SHSTSHDSYGSGYSADAGASSASY------GSSGHGGWGRSI----DAQDLAYGAQK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 24/116 (21%)
Osi7NP_649626.1 DUF1676 46..217 CDD:400313 51/179 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.