DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi18 and Osi6

DIOPT Version :9

Sequence 1:NP_649639.1 Gene:Osi18 / 40775 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001287192.1 Gene:Osi6 / 40760 FlyBaseID:FBgn0027527 Length:312 Species:Drosophila melanogaster


Alignment Length:210 Identity:50/210 - (23%)
Similarity:86/210 - (40%) Gaps:38/210 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ACLIVALAALSTAHSAPTEGQVAPQSATQLALDMYHGCLKDLSVSCVRPKALQWFNSALRQPEVR 70
            ||:::..|.:|.......|.|  |.:..|        ||:..|:||::....:...|....|::.
  Fly    34 ACILLLAAGISADPVKAAEEQ--PGAFAQ--------CLESDSISCLQLTLFRKAKSVFDNPQIE 88

  Fly    71 ITERLSIVRT-----------------AEKVESRSMNPEERLFDDIDSYLGSHSLRIQAPEYFRT 118
            :...:|:|::                 |..||:|:........|:..|:....||........| 
  Fly    89 LFGGVSLVKSNEGRQGKSLDNSLAVEAAPTVEARTAEMGNYFMDNAKSFFAERSLNFNFANAAR- 152

  Fly   119 SEARSLVPDFLMSNPLTQGGLVPLAAANEGR-GMIRKAVLPFLLGLKLKTTVL-VPLALGLIALK 181
            |.||: :||.:.::      |..|...:..| ..:.|..||.|||:..|..|| |....||:.|.
  Fly   153 SVARA-IPDDIKAD------LRELVVESRTRKKKLLKKFLPILLGVGAKIAVLGVGSIFGLLFLA 210

  Fly   182 TWKAMTLGLLSLVLS 196
            . ||:.:.:::..|:
  Fly   211 K-KALVVSVIAFFLA 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 22/115 (19%)
Osi6NP_001287192.1 DUF1676 81..176 CDD:285181 19/102 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.