DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi18 and Osi5

DIOPT Version :9

Sequence 1:NP_649639.1 Gene:Osi18 / 40775 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_649624.1 Gene:Osi5 / 40759 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster


Alignment Length:170 Identity:39/170 - (22%)
Similarity:72/170 - (42%) Gaps:45/170 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CLKDLSVS--CVRPKALQWFNSALRQPEVRITERLSIVRTAEKV--ESRSMNPEE-----RLFDD 98
            |.:|...:  |...:||:   :.||... |..:.|.::|..|.|  ::.|::.||     .|.|.
  Fly    21 CDQDAGATLYCRGERALR---NVLRNLN-RSDKPLVVIRGLEIVPLQNNSISDEEPDQEQGLLDS 81

  Fly    99 IDSYLGSHSLRIQAPEYF----RTSEARSLVPDFLMSNPLTQGGLVPLAAANEGRGMIRKAVLPF 159
            :..||.:|.:.::..:..    :.||||.                     .::|:||:....|.|
  Fly    82 LSFYLRTHEINVKLADLLEDESQVSEARK---------------------KDKGQGMLLAMALMF 125

  Fly   160 LLGLKLKTTVLVPLALGLIALKTWKAMTLGLLSLVLSGAL 199
                   ..::..:.||.||....||:.:.|::|:::|.|
  Fly   126 -------GKMMAVMGLGGIAALAMKALGVSLVALMMAGML 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 22/108 (20%)
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 18/86 (21%)
RCR 184..>201 CDD:304939
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.