DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi18 and Osi3

DIOPT Version :9

Sequence 1:NP_649639.1 Gene:Osi18 / 40775 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001262304.1 Gene:Osi3 / 40757 FlyBaseID:FBgn0037411 Length:288 Species:Drosophila melanogaster


Alignment Length:336 Identity:67/336 - (19%)
Similarity:122/336 - (36%) Gaps:84/336 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSTAACLIVA--LAALSTAHSAPTEGQVAPQSATQ------LALDMYHGCLKDLSVSCVRPKAL 57
            |::...|.::|  ...:|...|...:|.|....:.:      |...:...|.::...:|...|..
  Fly     1 MQTFKVCALLAFCFVLVSARGSKRRDGTVTISESERKNIEDFLLAKLKQNCRQEDDRACKMVKMS 65

  Fly    58 QWFNSALRQPEVRITERLSIVRT-----------AEKVESRSMNPEERLF-----DDIDSYLGSH 106
            ...|.......:.:.:|..:...           ..::.||||..:|..|     :.:..::.|.
  Fly    66 IVMNHLYLNTRIDLGDRFKVTENGNISMVPDDPEVNQLLSRSMGSDEETFALLMANKLWKFIRSR 130

  Fly   107 SLRIQAPEYFRTSEARSLVPDFLMSNPLTQGGL------VPLAAANEGRGMIRKAVLPFLLGLKL 165
            |||      ::.||....|   :.|:|  :|.|      .||.|..||||.: |.:.|.|:.:..
  Fly   131 SLR------YKFSENTDFV---INSDP--EGSLNLGVSVRPLEALQEGRGKM-KNMGPLLMMMAA 183

  Fly   166 KTTVLVPLALGLIALKTWKAMTLGLLSLVLSGALVIFKIAKPKIVNYEVVHYPHHVDHVVPHHIE 230
            ||.::..|.|..:.|...||:.:..::|:|:   ||..:.|.......:|..|.|.|......  
  Fly   184 KTGMVGALLLKGLFLLAGKALIVSKIALLLA---VIISLKKLLSSKKTIVEVPSHHDSYSSGW-- 243

  Fly   231 HVVPHHIEHVVPHHIEHIVPHHIDHHLEHHIDHHVDLPVEHIEHLEHPSPAWDPHAWARSSQEPQ 295
                               ....|..:|..:|...|:..:.::|                  :.:
  Fly   244 -------------------SRAFDGFVEGLVDVPADILAKEVQH------------------QQE 271

  Fly   296 DAQDLAYAGQK 306
            .||::||:||:
  Fly   272 QAQNMAYSGQQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 27/119 (23%)
Osi3NP_001262304.1 DUF1676 68..180 CDD:285181 29/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.