DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi18 and Osi16

DIOPT Version :9

Sequence 1:NP_649639.1 Gene:Osi18 / 40775 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_731065.1 Gene:Osi16 / 318801 FlyBaseID:FBgn0051561 Length:278 Species:Drosophila melanogaster


Alignment Length:256 Identity:67/256 - (26%)
Similarity:103/256 - (40%) Gaps:56/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LIVALAALSTAHSA-PTE-GQVAPQS--ATQLALDMYHGC-LKDLSVSCVRPKALQWFNSALRQP 67
            |...:...:||.|. ||| ..|||::  ..|.|..:..|| ....|..|::.:.::.......|.
  Fly    15 LFAFMCKYATAASVQPTEVPAVAPETIRIPQRAESLLSGCEASSFSWMCLKIEFVKIMEKLAEQE 79

  Fly    68 EVRITERLSIVR------------TAEKVESRSMNPEERL----FDDIDSYLGSHSLRIQAPEYF 116
            |:.:...:|:|:            .||...|...:|..||    ...:::.|.:..||      |
  Fly    80 ELNVLPGISVVKDENATELKTSELMAEVARSYPSDPSTRLNGYIVAKLENLLRTRFLR------F 138

  Fly   117 RTSEARSLVPDFLMSNPLTQGGLVPLAAANEGRGMIRKAVLPFLLGLKLKTTVLVPLALGLIALK 181
            |..:.:||| :........:|||..|.||    |::.|.             :|:.:.||.|||.
  Fly   139 RLLDDKSLV-EGRKHKFGKKGGLEALVAA----GVMMKG-------------MLMAMGLGAIALM 185

  Fly   182 TWKAMTLGLLSLVLSGALVIFKIA--KPKIVNYEVVHYPHHV---DHVVPH------HIEH 231
            ..||:...|::|.|||.|.:..:|  ..|...||:|..|.:.   .|.|.|      |..|
  Fly   186 AGKALMTALMALTLSGVLGLKSLAGGGGKSTTYEIVAKPIYTSSHSHSVTHEDGGHSHSPH 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 26/113 (23%)
Osi16NP_731065.1 DUF1676 72..156 CDD:285181 18/90 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.