DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi17 and Osi19

DIOPT Version :9

Sequence 1:NP_001262307.1 Gene:Osi17 / 40774 FlyBaseID:FBgn0037427 Length:750 Species:Drosophila melanogaster
Sequence 2:NP_649640.1 Gene:Osi19 / 40776 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster


Alignment Length:281 Identity:69/281 - (24%)
Similarity:111/281 - (39%) Gaps:59/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 LLLRLARRFASGNELWDGLVRDCYLKPDVSCFQKNVFSYLDNVLDVQDVNVTQRLKFFKNQVDYQ 205
            |:.....:.|||.:             .::|.::....::|||:......|        :.::.:
  Fly    31 LIAEEQNKCASGQD-------------SMACIKERAMRFVDNVMSKDSFQV--------SNLEVR 74

  Fly   206 VDKEKEEH-SEARAASAETPIEEVTSALYGKSIKFAMTHDLEVDLPEVMFNGATFRISPRAIEGN 269
            .:.||... :||||:||:..::.:.:.:.|        ||:.:|||   ...|...:|.|.:..|
  Fly    75 SNGEKTTPINEARASSADGFLDAIENYIRG--------HDVSMDLP---LADAKVTVSARNLVNN 128

  Fly   270 GIIAKLELIPKQ-----VVKARLAGAIIQKKIQKFLRSKLVLSFLALLLIIKIIKIKLFWLLPIV 329
            .:...|:|....     .|:||.....|.||.:|....||.:..|.|:|      :|...::|:.
  Fly   129 QLSLNLQLNGDDGDEGTDVEARGKKGNIFKKGKKHRLRKLAMPILVLIL------LKAITVIPMA 187

  Fly   330 IG---VGAAKKLLLKFLLFLFPALSHLFKLCSHYQQSYHAPAKYHHHHHLIDHHHTVVPPWHSGE 391
            ||   :.|...|.|.|..|:......:|:||....         |.|||..  |.|...||....
  Fly   188 IGILKIKAFNALALGFFSFIVSVGLAIFQLCKKIA---------HDHHHTA--HITAHGPWDGRT 241

  Fly   392 HHSVPEIIYTHPPK-GHPSAY 411
            ..|||..:...|.| |...||
  Fly   242 FSSVPAPVVEQPQKLGQALAY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi17NP_001262307.1 DUF1676 180..270 CDD:285181 21/90 (23%)
Prefoldin 603..>680 CDD:298833
DM4_12 661..745 CDD:299813
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 30/124 (24%)
DUF3671 <152..216 CDD:289205 18/69 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.