DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi17 and Osi14

DIOPT Version :9

Sequence 1:NP_001262307.1 Gene:Osi17 / 40774 FlyBaseID:FBgn0037427 Length:750 Species:Drosophila melanogaster
Sequence 2:NP_649635.1 Gene:Osi14 / 40770 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster


Alignment Length:214 Identity:53/214 - (24%)
Similarity:81/214 - (37%) Gaps:37/214 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 FPTRKPMDKMAPSDSLLLRLARRFASGNELWDGLVRDCYLKPDV-SCFQKNVFSYLDNVLDVQDV 189
            |......|.....|:.|.|.||...:           |....|: :|......:.|:......::
  Fly    18 FAAPSVQDNQVEGDNTLGRAARYLGA-----------CLESDDMATCLAVKGITALNRAARSNNI 71

  Fly   190 NVTQRLKFFKNQVDYQVDKEKEEHSEARAASAETP--IEEVTSALYGKSIK----FAMTHDLEVD 248
            .:...:.|.::... .|.:..:..|| :...||.|  .:|.|..|...::.    |..||:||..
  Fly    72 ELASGVTFQRDPAS-PVSRTGKSMSE-QDVYAELPQNADERTGRLVDLAVSSAADFLSTHNLEFK 134

  Fly   249 LPEVMFNGATFRISPRAI-EGNGIIAKLELIPKQVVKARLAGAIIQKKIQKFLRSKLVLSFLALL 312
            ||     ..|.:...||: ||.|.|.|:.......:.|:|...|           .|||.|||||
  Fly   135 LP-----AETTQQVARALDEGRGKIKKMLGPVALAIGAKLFAVI-----------PLVLGFLALL 183

  Fly   313 LIIKIIKIKLFWLLPIVIG 331
            ....:|..||.:.|.|::|
  Fly   184 TFKAVIVAKLAFFLAILVG 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi17NP_001262307.1 DUF1676 180..270 CDD:285181 23/96 (24%)
Prefoldin 603..>680 CDD:298833
DM4_12 661..745 CDD:299813
Osi14NP_649635.1 DUF1676 62..160 CDD:285181 26/104 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.