DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi17 and Osi9

DIOPT Version :9

Sequence 1:NP_001262307.1 Gene:Osi17 / 40774 FlyBaseID:FBgn0037427 Length:750 Species:Drosophila melanogaster
Sequence 2:NP_649628.2 Gene:Osi9 / 40763 FlyBaseID:FBgn0037416 Length:233 Species:Drosophila melanogaster


Alignment Length:245 Identity:58/245 - (23%)
Similarity:95/245 - (38%) Gaps:65/245 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 SDSLLLRLARRFASGNELWDGLVRDCYLKPDVSCFQKNVFSYLDNVLDVQDVNVTQRLKFFKNQV 202
            :||||....:           :|:||..:..|.|.::....|.|  .:..||.:|:.:...|.. 
  Fly    21 ADSLLTSALK-----------MVKDCGERSMVLCMKERALHYFD--AENGDVRLTEGIALVKTD- 71

  Fly   203 DYQV-----DKEKEEHSEARAASAETPIEEVTSALYGKSIKFAMTHDLEVDLPEVMFNGATFRIS 262
            :..|     :.:..|..|||.|       ||.|.|..:..:|..||.|:..:|:     .:.:..
  Fly    72 EIPVGRSLNEMQLPEEVEAREA-------EVDSLLVERVARFFGTHTLQFKVPK-----DSIQDM 124

  Fly   263 PRAIEGNGIIAKLELIPKQVVKARLAGAIIQKKIQKFLRSKLVLSFLALLLIIKIIKIKLFWLLP 327
            .||:|.:                  .|...:||  |:|...|:|           .|:|:..|||
  Fly   125 QRALEES------------------RGKKKEKK--KYLMPLLML-----------FKLKMAALLP 158

  Fly   328 IVIGVGAA---KKLLLKFLLFLFPALSHLFKLCSHYQQSYHAPAKYHHHH 374
            :.||..|.   |.|::..:..|...:..|.||....:::|...|..|:.|
  Fly   159 LAIGFLALISFKALVIGKIALLLSGIIGLKKLLESKKENYEVVAHPHYEH 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi17NP_001262307.1 DUF1676 180..270 CDD:285181 23/94 (24%)
Prefoldin 603..>680 CDD:298833
DM4_12 661..745 CDD:299813
Osi9NP_649628.2 DUF1676 54..144 CDD:285181 27/122 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.