DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi15 and Osi14

DIOPT Version :9

Sequence 1:NP_649636.1 Gene:Osi15 / 40771 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_649635.1 Gene:Osi14 / 40770 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster


Alignment Length:259 Identity:58/259 - (22%)
Similarity:96/259 - (37%) Gaps:71/259 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CVVLLASLVCGSMALPS-QDN-TERDL--------------------------VNMLNRLDSEES 43
            ||.|||:...  .|.|| ||| .|.|.                          :..|||.....:
  Fly     8 CVTLLAASCV--FAAPSVQDNQVEGDNTLGRAARYLGACLESDDMATCLAVKGITALNRAARSNN 70

  Fly    44 VALFGGLRIDR------SESGRSFGA----SKAVESFEDRAER-----------YLETHELNLSF 87
            :.|..|:...|      |.:|:|...    ::..::.::|..|           :|.||.|....
  Fly    71 IELASGVTFQRDPASPVSRTGKSMSEQDVYAELPQNADERTGRLVDLAVSSAADFLSTHNLEFKL 135

  Fly    88 SGDEQDENSENEYTGRAMDESRSKRMKKMLLPLLLALKLKKAVVVKIMFTIIKFISLKALAIS-- 150
            ..:      ..:...||:||.|.| :||||.|:.||:..|...|:.::...:..::.||:.::  
  Fly   136 PAE------TTQQVARALDEGRGK-IKKMLGPVALAIGAKLFAVIPLVLGFLALLTFKAVIVAKL 193

  Fly   151 --FLALILAGATFFKDLLAKKKEHITTAYITGSPLNADIVHSDWSRNGQAGAADLAYNHYGLAQ 212
              |||:::.|:........|         ..|:........:.||....||.:..|.:.|..|:
  Fly   194 AFFLAILVGGSRLLGGFGNK---------FGGNSFAGAYNSNAWSAPASAGWSSGASSSYPYAR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 36/182 (20%)
Osi14NP_649635.1 DUF1676 62..160 CDD:285181 25/104 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.