DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi15 and Osi8

DIOPT Version :9

Sequence 1:NP_649636.1 Gene:Osi15 / 40771 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_649627.1 Gene:Osi8 / 40762 FlyBaseID:FBgn0037415 Length:274 Species:Drosophila melanogaster


Alignment Length:221 Identity:56/221 - (25%)
Similarity:84/221 - (38%) Gaps:68/221 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SQDNTERDL-VNMLNRLD----SEESVALFGGLRIDRSESGRSFGASKAVESFED---------- 72
            |.||....| |.:|..|:    |.:|::|..|::. .|..|.|....:|..|.:|          
  Fly    69 SGDNMSVCLKVKLLTGLEKAFRSAKSLSLMEGIQF-VSSGGESEETKRAPISEKDIEAVLPRSVD 132

  Fly    73 ------------RAERYLETHELNLSFSGDEQDENSENEYTGRAMDESRSKRMKK-----MLLPL 120
                        |...:|:.|.|.:.|      :|..|..      |.|.|:.||     :::||
  Fly   133 AKEQVLNNMILKRVGNFLQDHTLQVKF------DNEANSV------EGRKKKEKKGNGAMIMIPL 185

  Fly   121 LLALKLKKAVVVKIMFTIIKFISLKALAISFLALILAGATFFKDLLA-----KKKEHITTAYITG 180
            ||.     ..:|.:.:..:..::.|||.:|.|||:||.....|.||:     |:..|.......|
  Fly   186 LLG-----GTIVPLAYGALAMLAGKALIVSKLALVLASIIGIKKLLSGGGGGKESSHEVVVSSGG 245

  Fly   181 SPLNADIVHSDWSRNGQAGAADLAYN 206
                    ||.|.|.     .|.||:
  Fly   246 --------HSGWGRE-----LDTAYS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 40/163 (25%)
Osi8NP_649627.1 DUF1676 85..>169 CDD:285181 19/96 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.