DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi15 and Osi6

DIOPT Version :9

Sequence 1:NP_649636.1 Gene:Osi15 / 40771 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001287192.1 Gene:Osi6 / 40760 FlyBaseID:FBgn0027527 Length:312 Species:Drosophila melanogaster


Alignment Length:285 Identity:63/285 - (22%)
Similarity:105/285 - (36%) Gaps:87/285 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CVVLLASLVCGSMALPSQDN-------TERDLVNML--------NRLDSEESVALFGGLRIDRSE 56
            |::|||:.:.......:::.       .|.|.::.|        ..:.....:.||||:.:.:|.
  Fly    35 CILLLAAGISADPVKAAEEQPGAFAQCLESDSISCLQLTLFRKAKSVFDNPQIELFGGVSLVKSN 99

  Fly    57 SGR---SFGASKAVES--------------FEDRAERYLETHELNLSFSGDEQDENSENEYTGRA 104
            .||   |...|.|||:              |.|.|:.:.....||.:|:...:.       ..||
  Fly   100 EGRQGKSLDNSLAVEAAPTVEARTAEMGNYFMDNAKSFFAERSLNFNFANAARS-------VARA 157

  Fly   105 MDE--------------SRSKRMKKMLLPLLLALKLKKAVV-VKIMFTIIKFISLKALAISFLAL 154
            :.:              :|.|::.|..||:||.:..|.||: |..:|.:: |::.|||.:|.:|.
  Fly   158 IPDDIKADLRELVVESRTRKKKLLKKFLPILLGVGAKIAVLGVGSIFGLL-FLAKKALVVSVIAF 221

  Fly   155 IL---AGATF-----------------FKDLLAKKKEHITTAYITGS-PLNADIVHSDWSRNGQA 198
            .|   |||:.                 ...|...|....::|..||. ........:.||..|.:
  Fly   222 FLALAAGASSGLGRIGGSGGGGGLLGGLGGLFGGKNAGGSSAASTGGWSSGGGASSAGWSSGGSS 286

  Fly   199 G-----------AADLAYNHYGLAQ 212
            |           |..:||..|..|:
  Fly   287 GWDTHGAYSSPVAQTIAYQGYKQAR 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 43/191 (23%)
Osi6NP_001287192.1 DUF1676 81..176 CDD:285181 20/101 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.