DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi15 and Osi3

DIOPT Version :9

Sequence 1:NP_649636.1 Gene:Osi15 / 40771 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001262304.1 Gene:Osi3 / 40757 FlyBaseID:FBgn0037411 Length:288 Species:Drosophila melanogaster


Alignment Length:223 Identity:55/223 - (24%)
Similarity:88/223 - (39%) Gaps:71/223 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CVVLLASLVCGSMALPSQDNTERDLVNMLNRLDSEESVALFGGLRIDRSESG------------- 58
            |.::..|:|...:.|    ||..||                 |.|...:|:|             
  Fly    59 CKMVKMSIVMNHLYL----NTRIDL-----------------GDRFKVTENGNISMVPDDPEVNQ 102

  Fly    59 ---RSFGASKAVESF----EDRAERYLETHELNLSFSGDEQDENSE----NEYTG---------- 102
               ||.|:.:  |:|    .::..:::.:..|...||     ||::    ::..|          
  Fly   103 LLSRSMGSDE--ETFALLMANKLWKFIRSRSLRYKFS-----ENTDFVINSDPEGSLNLGVSVRP 160

  Fly   103 -RAMDESRSKRMKKMLLPLLLALKLKKAVVVKIMFTIIKFISLKALAISFLALILAGATFFKDLL 166
             .|:.|.|.| ||.| .|||:.:..|..:|..::...:..::.|||.:|.:||:||.....|.||
  Fly   161 LEALQEGRGK-MKNM-GPLLMMMAAKTGMVGALLLKGLFLLAGKALIVSKIALLLAVIISLKKLL 223

  Fly   167 AKKKEHITTAYITGSPLNADIVHSDWSR 194
            :.||.      |...|.:.|...|.|||
  Fly   224 SSKKT------IVEVPSHHDSYSSGWSR 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 36/166 (22%)
Osi3NP_001262304.1 DUF1676 68..180 CDD:285181 30/141 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.