DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi14 and Osi19

DIOPT Version :9

Sequence 1:NP_649635.1 Gene:Osi14 / 40770 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_649640.1 Gene:Osi19 / 40776 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster


Alignment Length:279 Identity:56/279 - (20%)
Similarity:99/279 - (35%) Gaps:58/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VFAAPSVQDNQVEGDNT--LGR-AARYLGACLESDDMATCLAVKGITALNRAARSNNIELAS-GV 77
            |..|..|...|..|.:|  :.| .|.....|....|...|:..:.:..::.....::.:::: .|
  Fly     9 VGVAALVAAGQAAGGSTEKMQRLIAEEQNKCASGQDSMACIKERAMRFVDNVMSKDSFQVSNLEV 73

  Fly    78 TFQRDPASPVSRTGKSMSE------------QDVYAELPQNADERTGRLVDLAVSSAADFLSTHN 130
            ....:..:|::....|.::            .||..:||         |.|..|:.:|..|..:.
  Fly    74 RSNGEKTTPINEARASSADGFLDAIENYIRGHDVSMDLP---------LADAKVTVSARNLVNNQ 129

  Fly   131 LEFKLPAETTQQVARALDEG-----RGK------------IKKMLGPVALAIGAKLFAVIPLVLG 178
            |...|.......     |||     |||            ::|:..|:.:.|..|...|||:.:|
  Fly   130 LSLNLQLNGDDG-----DEGTDVEARGKKGNIFKKGKKHRLRKLAMPILVLILLKAITVIPMAIG 189

  Fly   179 FLALLTFKAVIVAKLAFFLAILVGGSRLLGGFGNKFGGNSFAGAYNSNAWSAPASAGWSSGASSS 243
            .|.:..|.|:.:...:|.:::.:...:|.         ...|..::..| ...|...|.....||
  Fly   190 ILKIKAFNALALGFFSFIVSVGLAIFQLC---------KKIAHDHHHTA-HITAHGPWDGRTFSS 244

  Fly   244 YPYARSISEDGSDAQQLAY 262
            .| |..:.:.....|.|||
  Fly   245 VP-APVVEQPQKLGQALAY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi14NP_649635.1 DUF1676 62..160 CDD:285181 21/127 (17%)
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 20/119 (17%)
DUF3671 <152..216 CDD:289205 13/63 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.