DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi14 and Osi18

DIOPT Version :9

Sequence 1:NP_649635.1 Gene:Osi14 / 40770 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_649639.1 Gene:Osi18 / 40775 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster


Alignment Length:343 Identity:72/343 - (20%)
Similarity:113/343 - (32%) Gaps:125/343 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AC--VTLLAASCVFAAPSVQDNQVEGDNTLGRAARYLGACLESDDMATCLAVKGITALNRAARSN 69
            ||  |.|.|.|...:||:  :.||...:....|......||: |...:|:..|.:...|.|.|..
  Fly     6 ACLIVALAALSTAHSAPT--EGQVAPQSATQLALDMYHGCLK-DLSVSCVRPKALQWFNSALRQP 67

  Fly    70 NIELASGVTFQRDPASPVSRTGKSMSEQDVYAELPQNADERTGRLVDLAVSSAADFLSTHNLEFK 134
            .:.:...::..|......||:              .|.:||....:|       .:|.:|:|..:
  Fly    68 EVRITERLSIVRTAEKVESRS--------------MNPEERLFDDID-------SYLGSHSLRIQ 111

  Fly   135 LPAETTQQVARAL---------------------DEGRGKIKKMLGPVALAIGAKLFAVIPLVLG 178
            .|.......||:|                     :||||.|:|.:.|..|.:..|...::||.||
  Fly   112 APEYFRTSEARSLVPDFLMSNPLTQGGLVPLAAANEGRGMIRKAVLPFLLGLKLKTTVLVPLALG 176

  Fly   179 FLALLTFKAVIVAKLAFFLAILVGGSRLLGGFGNKFGGNSFAGAY-------------------- 223
            .:||.|:||:.:.    .|::::.|:.::.........|.....|                    
  Fly   177 LIALKTWKAMTLG----LLSLVLSGALVIFKIAKPKIVNYEVVHYPHHVDHVVPHHIEHVVPHHI 237

  Fly   224 ----------------------------------------NSNAWSAPASAGWSSGASSSYPYAR 248
                                                    .|.||...|             :||
  Fly   238 EHVVPHHIEHIVPHHIDHHLEHHIDHHVDLPVEHIEHLEHPSPAWDPHA-------------WAR 289

  Fly   249 SISEDGSDAQQLAYAGQQ 266
            | |::..|||.||||||:
  Fly   290 S-SQEPQDAQDLAYAGQK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi14NP_649635.1 DUF1676 62..160 CDD:285181 23/118 (19%)
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 23/118 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.